PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009591627.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 609aa    MW: 65899.7 Da    PI: 6.8368
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009591627.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.12.9e-31254311260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers  +++++ei+Y+g+H+h+k
  XP_009591627.1 254 DDGYNWRKYGQKLVKGSEFPRSYYKCTYPNCEVKKIFERSP-EGQITEIVYKGSHDHPK 311
                     8****************************************.***************85 PP

2WRKY106.11.8e-33425483159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  XP_009591627.1 425 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 483
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-26244312IPR003657WRKY domain
PROSITE profilePS5081122.435248312IPR003657WRKY domain
SuperFamilySSF1182902.48E-24250312IPR003657WRKY domain
SMARTSM007743.4E-33253311IPR003657WRKY domain
PfamPF031069.5E-24254310IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.5E-37410485IPR003657WRKY domain
SuperFamilySSF1182902.48E-29417485IPR003657WRKY domain
PROSITE profilePS5081138.825420485IPR003657WRKY domain
SMARTSM007743.1E-39425484IPR003657WRKY domain
PfamPF031063.7E-26426483IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 609 aa     Download sequence    Send to blast
MEDSQSQSQS HYSQQYSHSS PLPSINESSE QQLKISSSDA SAVGSNSSRG AKYKLMSPAK  60
LPISRSACIT IPPGLSPSSF LESPVLLSNI KAEPSPTTGS FSKFQLMQGS SGSAALSFMR  120
SCSSGNAYGE TTGEFEFKFA IGSSSTSGSL AKEAATFAGL NQQQSEPLNQ IQDRYLFQSF  180
APSALVRSEM PNSKEVSLPA PVSLDASSIS TAAADAAAID NEEISQRGHS NPSSQGSHAD  240
NRDVSSITAE RSSDDGYNWR KYGQKLVKGS EFPRSYYKCT YPNCEVKKIF ERSPEGQITE  300
IVYKGSHDHP KPQPSRRFTP GALTSIQEDR SEKEASFTGQ EDKFNTNAYT SNIEPSSTPV  360
SPRLAEDDGL EGTVSQLQSA NDQLDEDDPF AKRRKMDGGM DITPVVKPIR EPRVVVQTVS  420
EVDILDDGYR WRKYGQKVVR GNPNPRSYYK CTNAGCPVRK HVERASHDPK AVITTYEGKH  480
NHDVPTARNH SHEMAGSAPV TGSSRVRAEE NGSISLDLGV GIGYGMENRS NGQLHTRPAE  540
NVRNQVQVSS SSMMVVQPGA VAACYGIVNG GMSRFGSIDN RIQGTGFESL PLQPSTQCPQ  600
NYGRIILGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-37254485877Probable WRKY transcription factor 4
2lex_A1e-37254485877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7111310.0AB711131.1 Nicotiana benthamiana NbWRKY10 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591627.10.0PREDICTED: probable WRKY transcription factor 20 isoform X1
SwissprotQ93WV01e-156WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A0P0UVU30.0A0A0P0UVU3_NICBE; Transcription factor
STRINGPGSC0003DMT4000766700.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40252344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-151WRKY family protein